Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENOPH1 Peptide - middle region

ENOPH1 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp586M0524, E1, FLJ12594, MASA, MST145

UniProt

Q9UHY7

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ENOPH1 Rabbit Polyclonal Antibody (orb326213) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_067027

Preservative

Lyophilized powder

AA Sequence

TDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

hsa-miR-4526 Primers
MPH02769 150 µL - 10 µM

hsa-miR-4526 Primers

Sign In for Pricing
View Details
IFITM1 Antibody
orb239586-01 50 µg

IFITM1 Antibody

Sign In for Pricing
View Details
IFITM1 Antibody
orb239586-02 100 µg

IFITM1 Antibody

Sign In for Pricing
View Details
Acetyl Lysine Polyclonal Antibody, HRP Conjugated
bs-8850R-HRP 100 µL

Acetyl Lysine Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Human anti-human activin A mAb (2N2)
A09D54-2N2 1 Each

Human anti-human activin A mAb (2N2)

Sign In for Pricing
View Details
Cyclin L1 (CCNL1) Antibody
abx111859 100 µL

Cyclin L1 (CCNL1) Antibody

Sign In for Pricing
View Details