Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENOPH1 Peptide - middle region

ENOPH1 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp586M0524, E1, FLJ12594, MASA, MST145

UniProt

Q9UHY7

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ENOPH1 Rabbit Polyclonal Antibody (orb326213) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_067027

Preservative

Lyophilized powder

AA Sequence

TDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DBC1 Protein Vector (Mouse) (pPB-C-His)
PV170526 500 ng

DBC1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
FOXC1 Protein Vector (Mouse) (pPM-C-His)
PV180037 500 ng

FOXC1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
RUVBL1 Antibody
orb39118-01 50 µg

RUVBL1 Antibody

Sign In for Pricing
View Details
RUVBL1 Antibody
orb39118-02 100 µg

RUVBL1 Antibody

Sign In for Pricing
View Details
CD82 (Kangai 1, R2, 4F9, C33, IA4, ST6, GR15, KAI1, SAR2, TSPAN27, R2 Leukocyte Antigen, Suppression of Tumorigenicity 6) (MaxLight 550)
MBS6410487-01 0.1 mL

CD82 (Kangai 1, R2, 4F9, C33, IA4, ST6, GR15, KAI1, SAR2, TSPAN27, R2 Leukocyte Antigen, Suppression of Tumorigenicity 6) (MaxLight 550)

Sign In for Pricing
View Details
CD82 (Kangai 1, R2, 4F9, C33, IA4, ST6, GR15, KAI1, SAR2, TSPAN27, R2 Leukocyte Antigen, Suppression of Tumorigenicity 6) (MaxLight 550)
MBS6410487-02 5x 0.1 mL

CD82 (Kangai 1, R2, 4F9, C33, IA4, ST6, GR15, KAI1, SAR2, TSPAN27, R2 Leukocyte Antigen, Suppression of Tumorigenicity 6) (MaxLight 550)

Sign In for Pricing
View Details