ENOPH1 Peptide - middle region
ENOPH1 Peptide - middle region
Product Specifications
Product Name Alternative
DKFZp586M0524, E1, FLJ12594, MASA, MST145
UniProt
Q9UHY7
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ENOPH1 Rabbit Polyclonal Antibody (orb326213) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_067027
Preservative
Lyophilized powder
AA Sequence
TDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K3821205 3x 1.0 µg
Htr1a sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
Sign In for Pricing
View Details 
QP12248-EC-100ug 100ug
Recombinant HIV-1 gp41 Protein, Untagged, E.coli-100ug
Sign In for Pricing
View Details 
VAng-Lsx6751-50gEcoli 50 µg (E. coli)
Recombinant Chlamydophila Trachomatis grpE Protein (aa 1-190) (strain HAR-13 / ATCC VR-571B)
Sign In for Pricing
View Details 250127-ML750 100 µL
PIP5K1A (Phosphatidylinositol-4-Phosphate 5-Kinase, Type I, alpha) (MaxLight 750) discontinued
Sign In for Pricing
View Details