Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENOX2 Peptide - N-terminal region

ENOX2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

APK1, COVA1, tNOX

UniProt

Q32ND0

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ENOX2 Rabbit Polyclonal Antibody (orb584490) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006366

Preservative

Lyophilized powder

AA Sequence

YRIRLGSSTDKKDTGRLHVDFAQARDDLYEWECKQRMLAREERHRRRMEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Microfibril-associated glycoprotein 3 (MFAP3)
orb2902571-01 20 µg

Recombinant Human Microfibril-associated glycoprotein 3 (MFAP3)

Sign In for Pricing
View Details
Recombinant Human Microfibril-associated glycoprotein 3 (MFAP3)
orb2902571-02 100 µg

Recombinant Human Microfibril-associated glycoprotein 3 (MFAP3)

Sign In for Pricing
View Details
NOS3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV687230 1.0 µg DNA

NOS3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Recombinant Rhopalurus junceus Putative alpha-neurotoxin RjAa13
MBS1003687-01 0.02 mg (E-Coli)

Recombinant Rhopalurus junceus Putative alpha-neurotoxin RjAa13

Sign In for Pricing
View Details
Recombinant Rhopalurus junceus Putative alpha-neurotoxin RjAa13
MBS1003687-02 0.1 mg (E-Coli)

Recombinant Rhopalurus junceus Putative alpha-neurotoxin RjAa13

Sign In for Pricing
View Details
Recombinant Rhopalurus junceus Putative alpha-neurotoxin RjAa13
MBS1003687-03 0.02 mg (Yeast)

Recombinant Rhopalurus junceus Putative alpha-neurotoxin RjAa13

Sign In for Pricing
View Details