ENSA Peptide - N-terminal region
ENSA Peptide - N-terminal region
Product Specifications
Product Name Alternative
MGC4319, MGC78563, MGC8394, ARPP-19e
UniProt
O43768
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ENSA Rabbit Polyclonal Antibody (orb582104) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_996930
Preservative
Lyophilized powder
AA Sequence
MAGGLGCDVCYWFVEDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![RAIDD (CRADD) (full length) Mouse Monoclonal Antibody [Clone ID: 4B12]](https://cdn.genprice.uk/products/937/68dd189c061270361e8fcd01/imageurl/am26605af-n.webp)
AM26605AF-N 100 µg
RAIDD (CRADD) (full length) Mouse Monoclonal Antibody [Clone ID: 4B12]
Sign In for Pricing
View Details 
LY423689 100 µg
WBP5 (TCEAL9) (NM_001006613) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNC681964-500 1x 500 µL
NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/1964), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 