Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENSA Peptide - N-terminal region

ENSA Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC4319, MGC78563, MGC8394, ARPP-19e

UniProt

O43768

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ENSA Rabbit Polyclonal Antibody (orb582104) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_996930

Preservative

Lyophilized powder

AA Sequence

MAGGLGCDVCYWFVEDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CF®583R Maleimide
#96107 1x 1 µmol

CF®583R Maleimide

Sign In for Pricing
View Details
Cd1d2 Mouse Gene Knockout Kit (CRISPR)
KN502872 1 Kit

Cd1d2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ABD-F
#91046 1x 10 mg

ABD-F

Sign In for Pricing
View Details
NBL1 Antibody (Biotin)
KB-8114-01 50 μL

NBL1 Antibody (Biotin)

Sign In for Pricing
View Details
NBL1 Antibody (Biotin)
KB-8114-02 100 µL

NBL1 Antibody (Biotin)

Sign In for Pricing
View Details
NBL1 Antibody (Biotin)
KB-8114-03 1 mL

NBL1 Antibody (Biotin)

Sign In for Pricing
View Details