Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPB49 Peptide - middle region

EPB49 Peptide - middle region

Product Specifications

Product Name Alternative

DMT, FLJ78462, FLJ98848, EPB49

UniProt

Q08495

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EPB49 Rabbit Polyclonal Antibody (orb326398) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001969

Preservative

Lyophilized powder

AA Sequence

KKPPIYKQRESVGGSPQTKHLIEDLIIESSKFPAAQPPDPNQPAKIETDY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Netrin 1 Rabbit monoclonal antibody
E43S40863 100 µL

Netrin 1 Rabbit monoclonal antibody

Sign In for Pricing
View Details
Rabbit Polyclonal KMT2D Antibody
NBP1-89123 0.1 mL

Rabbit Polyclonal KMT2D Antibody

Sign In for Pricing
View Details
Txn1 Mouse Gene Knockout Kit (CRISPR)
KN318506 1 Kit

Txn1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DCBLD2 Polyclonal Antibody, PerCP Conjugated
bs-5834R-PerCP 100 µL

DCBLD2 Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
XPO5 Protein Vector (Human) (pPM-C-HA)
50557021 500 ng

XPO5 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
1,2,3,7,8,9-Hexachlorodibenzofuran
TRC-H265090-5MG 5 mg

1,2,3,7,8,9-Hexachlorodibenzofuran

Sign In for Pricing
View Details