Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPB49 Peptide - middle region

EPB49 Peptide - middle region

Product Specifications

Product Name Alternative

DMT, FLJ78462, FLJ98848, EPB49

UniProt

Q08495

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EPB49 Rabbit Polyclonal Antibody (orb326398) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001969

Preservative

Lyophilized powder

AA Sequence

KKPPIYKQRESVGGSPQTKHLIEDLIIESSKFPAAQPPDPNQPAKIETDY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant human Isoform 2 of Polyribonucleotide 5'-hydroxyl-kinase Clp1
P2786 100 µg

Recombinant human Isoform 2 of Polyribonucleotide 5'-hydroxyl-kinase Clp1

Sign In for Pricing
View Details
Hs1bp3 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4824504 1.0 µg DNA

Hs1bp3 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Recombinant Macaca mulatta Inactive serine protease 35 (PRSS35)
MBS1425015-01 0.02 mg (E-Coli)

Recombinant Macaca mulatta Inactive serine protease 35 (PRSS35)

Sign In for Pricing
View Details
Recombinant Macaca mulatta Inactive serine protease 35 (PRSS35)
MBS1425015-02 0.02 mg (Yeast)

Recombinant Macaca mulatta Inactive serine protease 35 (PRSS35)

Sign In for Pricing
View Details
Recombinant Macaca mulatta Inactive serine protease 35 (PRSS35)
MBS1425015-03 0.1 mg (E-Coli)

Recombinant Macaca mulatta Inactive serine protease 35 (PRSS35)

Sign In for Pricing
View Details
Recombinant Macaca mulatta Inactive serine protease 35 (PRSS35)
MBS1425015-04 0.1 mg (Yeast)

Recombinant Macaca mulatta Inactive serine protease 35 (PRSS35)

Sign In for Pricing
View Details