Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPHX1 Peptide - N-terminal region

EPHX1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

EPHX, EPOX, MEH, HYL1

UniProt

P07099

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EPHX1 Rabbit Polyclonal Antibody (orb582267) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000111

Preservative

Lyophilized powder

AA Sequence

GPGTRSAAREDDSIRPFKVETSDEEIHDLHQRIDKFRFTPPLEDSCFHYG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prph (NM_001163589) Mouse Tagged Lenti ORF Clone
MR207614L3 10 µg

Prph (NM_001163589) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CBLN2 Rabbit Polyclonal Antibody (AP)
orb916515 100 µL

CBLN2 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
a-Terpinene (~90%)
TRC-T117505-100MG 100 mg

a-Terpinene (~90%)

Sign In for Pricing
View Details
Rabbit anti Barley seedlings Oxalate oxidase, conjugated with Biotin
MBS573409-01 1 mL

Rabbit anti Barley seedlings Oxalate oxidase, conjugated with Biotin

Sign In for Pricing
View Details
Rabbit anti Barley seedlings Oxalate oxidase, conjugated with Biotin
MBS573409-02 5x 1 mL

Rabbit anti Barley seedlings Oxalate oxidase, conjugated with Biotin

Sign In for Pricing
View Details
Rabbit Polyclonal DHRS7C Antibody
NBP3-10767-100ul 100 µL

Rabbit Polyclonal DHRS7C Antibody

Sign In for Pricing
View Details