Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPHX1 Peptide - N-terminal region

EPHX1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

EPHX, EPOX, MEH, HYL1

UniProt

P07099

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EPHX1 Rabbit Polyclonal Antibody (orb582267) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000111

Preservative

Lyophilized powder

AA Sequence

GPGTRSAAREDDSIRPFKVETSDEEIHDLHQRIDKFRFTPPLEDSCFHYG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Heart
CS605830 5x 5 µm

Frozen Tissue Sections, Heart

Sign In for Pricing
View Details
Rabbit anti Aspergillus niger Glucose oxidase, conjugated with Biotin
MBS573529-01 1 mL

Rabbit anti Aspergillus niger Glucose oxidase, conjugated with Biotin

Sign In for Pricing
View Details
Rabbit anti Aspergillus niger Glucose oxidase, conjugated with Biotin
MBS573529-02 5x 1 mL

Rabbit anti Aspergillus niger Glucose oxidase, conjugated with Biotin

Sign In for Pricing
View Details
Human JUND Pre-designed siRNA Set B
SI007931B 1 Each

Human JUND Pre-designed siRNA Set B

Sign In for Pricing
View Details
Recombinant Dickeya zeae NADH-quinone oxidoreductase subunit K (nuoK)
MBS1248850 Inquire

Recombinant Dickeya zeae NADH-quinone oxidoreductase subunit K (nuoK)

Sign In for Pricing
View Details
MET, Phosphorylated (Y1349) (Hepatocyte Growth Factor Receptor, HGF, AUTS9, Scatter Factor Receptor, HGFR, RCCP2, c-MET) (HRP)
MBS6426621-01 0.1 mL

MET, Phosphorylated (Y1349) (Hepatocyte Growth Factor Receptor, HGF, AUTS9, Scatter Factor Receptor, HGFR, RCCP2, c-MET) (HRP)

Sign In for Pricing
View Details