What is the catalog number for Epor Peptide - N-terminal region?

The catalog number for Epor Peptide - N-terminal region is orb2010832.

What sizes are available for Epor Peptide - N-terminal region?

Epor Peptide - N-terminal region is available in the following size(s): 100 µg.

Is Epor Peptide - N-terminal region in stock?

Epor Peptide - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

Epor Peptide - N-terminal region

Product Specifications

UniProt

P14753

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_034279

Preservative

Lyophilized powder

AA Sequence

SVRFWCSLPTADTSSFVPLELQVTEASGSPRYHRIIHINEVVLLDAPAGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E45M12310V-2 50 µL

Iduronate 2 sulfatase (IDS) Mouse Monoclonal Antibody [Clone 3B10]

Sign In for Pricing

View Details

abx343928-01 50 µL

Nicotinamide phosphoribosyltransferase (NAMPT) Antibody (HRP)

Sign In for Pricing

View Details

abx343928-02 100 µL

Nicotinamide phosphoribosyltransferase (NAMPT) Antibody (HRP)

Sign In for Pricing

View Details

abx343928-03 200 µL

Nicotinamide phosphoribosyltransferase (NAMPT) Antibody (HRP)

Sign In for Pricing

View Details

abx343928-04 1 mL

Nicotinamide phosphoribosyltransferase (NAMPT) Antibody (HRP)

Sign In for Pricing

View Details

AM33179PU-N 100 µg

MRP8/14 (S100A8/A9) Mouse Monoclonal Antibody [Clone ID: FP 89]

Sign In for Pricing

View Details