What is the catalog number for Epor Peptide - N-terminal region?

The catalog number for Epor Peptide - N-terminal region is orb2010832.

What sizes are available for Epor Peptide - N-terminal region?

Epor Peptide - N-terminal region is available in the following size(s): 100 µg.

Is Epor Peptide - N-terminal region in stock?

Epor Peptide - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

Epor Peptide - N-terminal region

Product Specifications

UniProt

P14753

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_034279

Preservative

Lyophilized powder

AA Sequence

SVRFWCSLPTADTSSFVPLELQVTEASGSPRYHRIIHINEVVLLDAPAGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMAB-02181-01 50 μL

Anti-ACACA Polyclonal Antibody 2

Sign In for Pricing

View Details

TMAB-02181-02 100 µL

Anti-ACACA Polyclonal Antibody 2

Sign In for Pricing

View Details

TMAB-02181-03 200 µL

Anti-ACACA Polyclonal Antibody 2

Sign In for Pricing

View Details

NB100-74350V 0.1 mL

Rabbit Polyclonal Aggrecan Neoepitope Antibody [DyLight 405]

Sign In for Pricing

View Details

E910387 100 µL

PEX16 Antibody

Sign In for Pricing

View Details

MR206125A1V 250 µL

Mouse Sh3bp5l (NM_024480) AAV Particle

Sign In for Pricing

View Details