Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eras Peptide - N-terminal region

Eras Peptide - N-terminal region

Product Specifications

Product Name Alternative

HRAS2, HRasp, Ha-Ras2, ecat5

UniProt

Q7TN89

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Eras Rabbit Polyclonal Antibody (orb582892) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_853526

Preservative

Lyophilized powder

AA Sequence

LPTKSSILDLSSGTPCTRSPEESHEAWAQCKDAGRQLPEYKAVVVGASGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Venetoclax Impurity 15
RM-V051415-01 10 mg

Venetoclax Impurity 15

Sign In for Pricing
View Details
Venetoclax Impurity 15
RM-V051415-02 25 mg

Venetoclax Impurity 15

Sign In for Pricing
View Details
Venetoclax Impurity 15
RM-V051415-03 50 mg

Venetoclax Impurity 15

Sign In for Pricing
View Details
Venetoclax Impurity 15
RM-V051415-04 100 mg

Venetoclax Impurity 15

Sign In for Pricing
View Details
Tmem176a (NM_025326) Mouse Tagged ORF Clone Lentiviral Particle
MR203031L3V 200 µL

Tmem176a (NM_025326) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
AK7 (Adenylate Kinase 7)
474982 100 µL

AK7 (Adenylate Kinase 7)

Sign In for Pricing
View Details