Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eras Peptide - N-terminal region

Eras Peptide - N-terminal region

Product Specifications

Product Name Alternative

HRAS2, HRasp, Ha-Ras2, ecat5

UniProt

Q7TN89

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Eras Rabbit Polyclonal Antibody (orb582892) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_853526

Preservative

Lyophilized powder

AA Sequence

LPTKSSILDLSSGTPCTRSPEESHEAWAQCKDAGRQLPEYKAVVVGASGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Factor H ELISA Assay
4067 1 Kit

Anti-Factor H ELISA Assay

Sign In for Pricing
View Details
RAB39B CRISPR All-in-one AAV vector set (with saCas9)(Human)
38332151 3x 1.0 µg DNA

RAB39B CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
ZNRD2 (NM_001303024) Human Tagged ORF Clone
RG236186 10 µg

ZNRD2 (NM_001303024) Human Tagged ORF Clone

Sign In for Pricing
View Details
ITPKC AAV Vector (Human) (CMV)
25204101 1 µg

ITPKC AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
ALDH5A1 siRNA (h)
sc-72480 10 µM

ALDH5A1 siRNA (h)

Sign In for Pricing
View Details
Recombinant Clostridium Kluyveri hisZ Protein (aa 1-391)
VAng-Lsx9593-50gEcoli 50 µg (E. coli)

Recombinant Clostridium Kluyveri hisZ Protein (aa 1-391)

Sign In for Pricing
View Details