Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ERC1 Peptide - C-terminal region

ERC1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Cast2, ELKS, FLJ31750, KIAA1081, MGC12974, RAB6IP2

UniProt

Q8IUD2

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ERC1 Rabbit Polyclonal Antibody (orb326294) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_829884

Preservative

Lyophilized powder

AA Sequence

KLMADNYEDDHFKSSHSNQTNHKPSPDQIIQPLLELDQNRSKLKLYIGHL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RIPPLY2 (NM_001009994) Human Recombinant Protein
TP320725M 100 µg

RIPPLY2 (NM_001009994) Human Recombinant Protein

Sign In for Pricing
View Details
N-Desacetyl-N-formyl Thiocolchicoside
TRC-D288410-25MG 25 mg

N-Desacetyl-N-formyl Thiocolchicoside

Sign In for Pricing
View Details
STCH (HSPA13) (83-95) Goat Polyclonal Antibody
AP32347PU-N 100 µg

STCH (HSPA13) (83-95) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Neurofilament (NEFM) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C4]
TA506794AM 100 µL

Neurofilament (NEFM) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C4]

Sign In for Pricing
View Details
NR2E1 Polyclonal Antibody
E-AB-66056-01 60 µL

NR2E1 Polyclonal Antibody

Sign In for Pricing
View Details
NR2E1 Polyclonal Antibody
E-AB-66056-02 120 µL

NR2E1 Polyclonal Antibody

Sign In for Pricing
View Details