Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ERC1 Peptide - C-terminal region

ERC1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Cast2, ELKS, FLJ31750, KIAA1081, MGC12974, RAB6IP2

UniProt

Q8IUD2

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ERC1 Rabbit Polyclonal Antibody (orb326294) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_829884

Preservative

Lyophilized powder

AA Sequence

KLMADNYEDDHFKSSHSNQTNHKPSPDQIIQPLLELDQNRSKLKLYIGHL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ramp4 2 (SERP2) (NM_001010897) Human Over-expression Lysate
LY423217 100 µg

Ramp4 2 (SERP2) (NM_001010897) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Total RNA, Colon
CR560193 5 µg

Tissue Total RNA, Colon

Sign In for Pricing
View Details
IFluor® 568 goat anti-rabbit IgG (H+L)
16622-AAT 200 µg

IFluor® 568 goat anti-rabbit IgG (H+L)

Sign In for Pricing
View Details
Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (VWF/2480), CF568 conjugate, 0.1mg/mL
BNC682480-100 1x 100 µL

Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (VWF/2480), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mosapride N-Oxide
TRC-M731015-5MG 5 mg

Mosapride N-Oxide

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL
BNC400253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details