Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ercc1 Peptide - C-terminal region

Ercc1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Ercc-1

UniProt

Q91VP3

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ercc1 Rabbit Polyclonal Antibody (orb582949) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031974

Preservative

Lyophilized powder

AA Sequence

LADCTLVLAWSAEEAGRYLETYKAYEQKPADLLMEKLEQNFLSRATECLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Olfr1028 (NM_001011774) AAV Particle
MR220483A1V 250 µL

Mouse Olfr1028 (NM_001011774) AAV Particle

Sign In for Pricing
View Details
Pigeon Cytidine Deaminase ELISA Kit
MBS055018 Inquire

Pigeon Cytidine Deaminase ELISA Kit

Sign In for Pricing
View Details
Recombinant PTS system sucrose-specific EIIBC component (scrA), partial
MBS1026864-01 1 mg (E-Coli)

Recombinant PTS system sucrose-specific EIIBC component (scrA), partial

Sign In for Pricing
View Details
Recombinant PTS system sucrose-specific EIIBC component (scrA), partial
MBS1026864-02 1 mg (Yeast)

Recombinant PTS system sucrose-specific EIIBC component (scrA), partial

Sign In for Pricing
View Details
CD31 antibody (FITC)
61R-CD31jMSFT 500 ug

CD31 antibody (FITC)

Sign In for Pricing
View Details
RANGE 14ELI - Rack of 9 electrical sockets (250 volts - 4000 watts - 16 amps) Rack in socket E & F; Wall outlet in socket E. (included PEXTBLALI14)
PRISELI14 each

RANGE 14ELI - Rack of 9 electrical sockets (250 volts - 4000 watts - 16 amps) Rack in socket E & F; Wall outlet in socket E. (included PEXTBLALI14)

Sign In for Pricing
View Details