Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ercc1 Peptide - C-terminal region

Ercc1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Ercc-1

UniProt

Q91VP3

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ercc1 Rabbit Polyclonal Antibody (orb582949) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031974

Preservative

Lyophilized powder

AA Sequence

LADCTLVLAWSAEEAGRYLETYKAYEQKPADLLMEKLEQNFLSRATECLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ovarian Granulosa Cells
ARP0532 0.5 Million

Mouse Ovarian Granulosa Cells

Sign In for Pricing
View Details
Mouse Monoclonal CD45 Antibody (F10-89-4) [Alexa Fluor 750]
NBP1-28509AF750 0.1 mL

Mouse Monoclonal CD45 Antibody (F10-89-4) [Alexa Fluor 750]

Sign In for Pricing
View Details
CAT Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV675755 1.0 µg DNA

CAT Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Recombinant Human Pellino E3 Ubiquitin Protein Ligase Family Member 2
32-4430-10 10 µg

Recombinant Human Pellino E3 Ubiquitin Protein Ligase Family Member 2

Sign In for Pricing
View Details
Rabbit Monoclonal HDAC1 Antibody (S09-7G9)
NBP3-19652-100ul 100 µL

Rabbit Monoclonal HDAC1 Antibody (S09-7G9)

Sign In for Pricing
View Details
Mycobacterium tuberculosis katG Antibody
E55A15963 100 µg

Mycobacterium tuberculosis katG Antibody

Sign In for Pricing
View Details