Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ERCC3 Peptide - N-terminal region

ERCC3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BTF2, GTF2H, RAD25, TFIIH, XPB

UniProt

P19447

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ERCC3 Rabbit Polyclonal Antibody (orb576472) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000113

Preservative

Lyophilized powder

AA Sequence

MGKRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bche AAV siRNA Pooled Vector
13218166 1.0 µg

Bche AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Prealbumin Protein Polyclonal Antibody
A57604-100 100 µL

Prealbumin Protein Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Hnrnpd shRNA (UAS) - Lentiviral mouse Hnrnpd shRNA (UAS, RFP) (25)
GTR15167315 1 Vial

Lentiviral mouse Hnrnpd shRNA (UAS) - Lentiviral mouse Hnrnpd shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
HP ELISA Kit| Goat Haptoglobin ELISA Kit
EF012573 96 Tests

HP ELISA Kit| Goat Haptoglobin ELISA Kit

Sign In for Pricing
View Details
PIWIL1, ID (Piwi-like Protein 1, HIWI) (MaxLight 650) discontinued
P4210-35B-ML650 100 µL

PIWIL1, ID (Piwi-like Protein 1, HIWI) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Olfr18 Protein Lysate (Mouse) with C-HA Tag
32962034 100 µg

Olfr18 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details