Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ERCC6L Peptide - N-terminal region

ERCC6L Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ20105, MGC131695, PICH

UniProt

Q2NKX8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ERCC6L Rabbit Polyclonal Antibody (orb583406) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060139

Preservative

Lyophilized powder

AA Sequence

GDLEEAFKLFNLAKDIFPNEKVLSRIQKIQEALEELAEQGDDEFTDVCNS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp869 3'UTR GFP Stable Cell Line
TU172895 1.0 mL

Zfp869 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
RPS17P9 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV783628 1.0 µg DNA

RPS17P9 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
4- (propan-2-ylsulfanyl) benzoic acid
sc-348412A 5 g

4- (propan-2-ylsulfanyl) benzoic acid

Sign In for Pricing
View Details
1-Chloro-3-ethoxy-2-fluoro-5- (trifluoromethyl) benzene
PC1016256-01 250 mg

1-Chloro-3-ethoxy-2-fluoro-5- (trifluoromethyl) benzene

Sign In for Pricing
View Details
1-Chloro-3-ethoxy-2-fluoro-5- (trifluoromethyl) benzene
PC1016256-02 500 mg

1-Chloro-3-ethoxy-2-fluoro-5- (trifluoromethyl) benzene

Sign In for Pricing
View Details
1-Chloro-3-ethoxy-2-fluoro-5- (trifluoromethyl) benzene
PC1016256-03 1 g

1-Chloro-3-ethoxy-2-fluoro-5- (trifluoromethyl) benzene

Sign In for Pricing
View Details