Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ERCC8 Peptide - middle region

ERCC8 Peptide - middle region

Product Specifications

Product Name Alternative

CKN1, CSA

UniProt

Q13216

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ERCC8 Rabbit Polyclonal Antibody (orb584044) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000073

Preservative

Lyophilized powder

AA Sequence

FQELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Factor H/CFH Antibody Picoband® (Biotine Conjugate)
A00562-3-Biotin 100 µg/Vial

Anti-Factor H/CFH Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details
ITCH (E3 Ubiquitin-protein Ligase Itchy Homolog, Itch, Atrophin-1-interacting Protein 4, AIP4, NFE2-associated Polypeptide 1, NAPP1, DJ468O1.1) (APC)
128616-APC 100 µL

ITCH (E3 Ubiquitin-protein Ligase Itchy Homolog, Itch, Atrophin-1-interacting Protein 4, AIP4, NFE2-associated Polypeptide 1, NAPP1, DJ468O1.1) (APC)

Sign In for Pricing
View Details
Recombinant Human AHR, N-His
MBS1573932-01 0.1 mg

Recombinant Human AHR, N-His

Sign In for Pricing
View Details
Recombinant Human AHR, N-His
MBS1573932-02 1 mg

Recombinant Human AHR, N-His

Sign In for Pricing
View Details
Recombinant Human AHR, N-His
MBS1573932-03 5x 1 mg

Recombinant Human AHR, N-His

Sign In for Pricing
View Details
Bekanamycin (sulfate)
HY-B1174A 1 Each

Bekanamycin (sulfate)

Sign In for Pricing
View Details