Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ERP29 Peptide - N-terminal region

ERP29 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C12orf8, ERp28, ERp31, PDI-DB, PDIA9

UniProt

P30040

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ERP29 Rabbit Polyclonal Antibody (orb330393) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006808

Preservative

Lyophilized powder

AA Sequence

MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SARS-CoV-2 Spike NTD Protein (C136F, Y144del, R190S, D215G, LA242-243del), His Tag (MALS verified)
SPD-C5229-100ug 100 µg

SARS-CoV-2 Spike NTD Protein (C136F, Y144del, R190S, D215G, LA242-243del), His Tag (MALS verified)

Sign In for Pricing
View Details
Human C7orf57 activation kit by CRISPRa
GA115268 1 Kit

Human C7orf57 activation kit by CRISPRa

Sign In for Pricing
View Details
Calnexin (Ab-583) Antibody
8B0463-AAT 50 µg

Calnexin (Ab-583) Antibody

Sign In for Pricing
View Details
(2E,4E)-2,4-Decadienoic Acid
TRC-D210580-250MG 250 mg

(2E,4E)-2,4-Decadienoic Acid

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS504621 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
USP26 Human Gene Knockout Kit (CRISPR)
KN423359 1 Kit

USP26 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details