Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Esr2 Peptide - N-terminal region

Esr2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ER[b], ERbeta, Estrb

UniProt

Q8BG65

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Esr2 Rabbit Polyclonal Antibody (orb576190) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997590

Preservative

Lyophilized powder

AA Sequence

IPSSYVESRHEYSAMTFYSPAVMNYSVPSSTGNLEGGPVRQTASPNVLWP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT121P 3'UTR Lenti-reporter-Luc Vector
25927081 1.0 µg

KRT121P 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Recombinant Human Interleukin-12 receptor subunit beta-1 (IL12RB1), partial
RPC29725-01 20 µg

Recombinant Human Interleukin-12 receptor subunit beta-1 (IL12RB1), partial

Sign In for Pricing
View Details
Recombinant Human Interleukin-12 receptor subunit beta-1 (IL12RB1), partial
RPC29725-02 100 µg

Recombinant Human Interleukin-12 receptor subunit beta-1 (IL12RB1), partial

Sign In for Pricing
View Details
Recombinant Human Interleukin-12 receptor subunit beta-1 (IL12RB1), partial
RPC29725-03 1 mg

Recombinant Human Interleukin-12 receptor subunit beta-1 (IL12RB1), partial

Sign In for Pricing
View Details
Horse Serine Palmitoyltransferase, Long Chain Base Subunit 2 ELISA Kit
MBS053066-01 48 Well

Horse Serine Palmitoyltransferase, Long Chain Base Subunit 2 ELISA Kit

Sign In for Pricing
View Details
Horse Serine Palmitoyltransferase, Long Chain Base Subunit 2 ELISA Kit
MBS053066-02 96 Well

Horse Serine Palmitoyltransferase, Long Chain Base Subunit 2 ELISA Kit

Sign In for Pricing
View Details