Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Esr2 Peptide - N-terminal region

Esr2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ER[b], ERbeta, Estrb

UniProt

Q8BG65

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Esr2 Rabbit Polyclonal Antibody (orb576190) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997590

Preservative

Lyophilized powder

AA Sequence

IPSSYVESRHEYSAMTFYSPAVMNYSVPSSTGNLEGGPVRQTASPNVLWP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Finerenone Impurity 28
RM-F260028-01 10 mg

Finerenone Impurity 28

Sign In for Pricing
View Details
Finerenone Impurity 28
RM-F260028-02 25 mg

Finerenone Impurity 28

Sign In for Pricing
View Details
Finerenone Impurity 28
RM-F260028-03 50 mg

Finerenone Impurity 28

Sign In for Pricing
View Details
Finerenone Impurity 28
RM-F260028-04 100 mg

Finerenone Impurity 28

Sign In for Pricing
View Details
HDAC5 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV667578 1.0 µg DNA

HDAC5 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Interleukin 2 (IL2)
MBS2124742-01 0.1 mL

FITC-Linked Monoclonal Antibody to Interleukin 2 (IL2)

Sign In for Pricing
View Details