Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Esrp2 Peptide - C-terminal region

Esrp2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

9530027K23Rik, Rbm35b

UniProt

Q8K0G8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Esrp2 Rabbit Polyclonal Antibody (orb578497) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_789808

Preservative

Lyophilized powder

AA Sequence

LLPAARVPAAATPLAYYPGPATQLYMNYTAYYPSPPVSPTTVGYLTTPPT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human TRIM28 Protein
E30P61904A 50 µg

Recombinant Human TRIM28 Protein

Sign In for Pricing
View Details
Zebrafish MRC1A Rabbit Polyclonal Antibody (APC)
orb3129875 100 µg

Zebrafish MRC1A Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
SLMO2 Lentiviral Activation Particles (m2)
sc-425989-LAC-2 200 µL

SLMO2 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Porcine Centromere/kinetochore protein zw10 homolog (ZW10) ELISA kit
GTR10450589 96 Well

Porcine Centromere/kinetochore protein zw10 homolog (ZW10) ELISA kit

Sign In for Pricing
View Details
LL37 (Human)
075-06 200 µg

LL37 (Human)

Sign In for Pricing
View Details
Rat Gamma-Secretase Activating Protein (gSAP) ELISA Kit
DLR-gSAP-Ra-96T 96 Tests

Rat Gamma-Secretase Activating Protein (gSAP) ELISA Kit

Sign In for Pricing
View Details