Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Esrp2 Peptide - C-terminal region

Esrp2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

9530027K23Rik, Rbm35b

UniProt

Q8K0G8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Esrp2 Rabbit Polyclonal Antibody (orb578497) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_789808

Preservative

Lyophilized powder

AA Sequence

LLPAARVPAAATPLAYYPGPATQLYMNYTAYYPSPPVSPTTVGYLTTPPT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dguok (NM_013764) Mouse Recombinant Protein
E45M43856M5 20 µg

Dguok (NM_013764) Mouse Recombinant Protein

Sign In for Pricing
View Details
DDO Recombinant Protein
OPCD02689-50UG 50 µg

DDO Recombinant Protein

Sign In for Pricing
View Details
TMEM17 (G-10)
sc-514433 200 µg/mL

TMEM17 (G-10)

Sign In for Pricing
View Details
CD20 (AT80)
sc-58982 200 µg/mL

CD20 (AT80)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Complement Component 3a (C3a)
MBS2150433-01 0.1 mL

APC_Cy7-Linked Monoclonal Antibody to Complement Component 3a (C3a)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Complement Component 3a (C3a)
MBS2150433-02 0.2 mL

APC_Cy7-Linked Monoclonal Antibody to Complement Component 3a (C3a)

Sign In for Pricing
View Details