Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Esrrg Peptide - middle region

Esrrg Peptide - middle region

Product Specifications

Product Name Alternative

Errg, Esrrg

UniProt

P62510

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Esrrg Rabbit Polyclonal Antibody (orb329649) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_976081

Preservative

Lyophilized powder

AA Sequence

RIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(9E,12E)-Octadeca-9,12-dienoic Acid
TRC-E338005-500MG 500 mg

(9E,12E)-Octadeca-9,12-dienoic Acid

Sign In for Pricing
View Details
Ceacam11 Mouse Gene Knockout Kit (CRISPR)
KN503087 1 Kit

Ceacam11 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ranbp3 Mouse Gene Knockout Kit (CRISPR)
KN514458 1 Kit

Ranbp3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Ache activation kit by CRISPRa
GA200021 1 Kit

Mouse Ache activation kit by CRISPRa

Sign In for Pricing
View Details
Aflatoxin B1
TRC-A357460-1MG 1 mg

Aflatoxin B1

Sign In for Pricing
View Details
FOXP3 (3G3), CF647 conjugate, 0.1mg/mL
BNC470645-100 1x 100 µL

FOXP3 (3G3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details