Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Esrrg Peptide - middle region

Esrrg Peptide - middle region

Product Specifications

Product Name Alternative

Errg, Esrrg

UniProt

P62510

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Esrrg Rabbit Polyclonal Antibody (orb329649) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_976081

Preservative

Lyophilized powder

AA Sequence

RIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kallikrein 4 (KLK4) Human Gene Knockout Kit (CRISPR)
KN424493 1 Kit

Kallikrein 4 (KLK4) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cib2 Mouse Gene Knockout Kit (CRISPR)
KN503344 1 Kit

Cib2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Pkia (NM_008862) Mouse Tagged ORF Clone
MG200113 10 µg

Pkia (NM_008862) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
FITC Conjugated Rabbit Polyclonal Antibody to Equine IgG
FA-2355-2 2 mL

FITC Conjugated Rabbit Polyclonal Antibody to Equine IgG

Sign In for Pricing
View Details
Tissue Protein Lysate, Spleen
CP565482 150 µg

Tissue Protein Lysate, Spleen

Sign In for Pricing
View Details
DOK1 Recombinant Rabbit Monoclonal Antibody [JE54-52]
ET7110-75 100 µL

DOK1 Recombinant Rabbit Monoclonal Antibody [JE54-52]

Sign In for Pricing
View Details