Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Etv2 Peptide - middle region

Etv2 Peptide - middle region

Product Specifications

Product Name Alternative

Etsrp71

UniProt

P41163

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Etv2 Rabbit Polyclonal Antibody (orb329886) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031985

Preservative

Lyophilized powder

AA Sequence

GHQSPAFTTPSKSNKQSDRATLTRYSKTNHRGPIQLWQFLLELLHDGARS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Monoclonal CD47 Antibody (ligufalimab) [PE]
NBP3-27992PE 0.1 mL

Human Monoclonal CD47 Antibody (ligufalimab) [PE]

Sign In for Pricing
View Details
15-LO2 (F-10)
sc-376795 200 µg/mL

15-LO2 (F-10)

Sign In for Pricing
View Details
Recombinant Human Protein SPMIP1 (SMIP1)
orb3004374-01 20 µg

Recombinant Human Protein SPMIP1 (SMIP1)

Sign In for Pricing
View Details
Recombinant Human Protein SPMIP1 (SMIP1)
orb3004374-02 100 µg

Recombinant Human Protein SPMIP1 (SMIP1)

Sign In for Pricing
View Details
Recombinant Human Protein SPMIP1 (SMIP1)
orb3004374-03 1 mg

Recombinant Human Protein SPMIP1 (SMIP1)

Sign In for Pricing
View Details
Rabbit Polyclonal MARVELD1 Antibody [DyLight 650]
NBP1-76243C 0.1 mL

Rabbit Polyclonal MARVELD1 Antibody [DyLight 650]

Sign In for Pricing
View Details