Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Etv2 Peptide - middle region

Etv2 Peptide - middle region

Product Specifications

Product Name Alternative

Etsrp71

UniProt

P41163

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Etv2 Rabbit Polyclonal Antibody (orb329886) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031985

Preservative

Lyophilized powder

AA Sequence

GHQSPAFTTPSKSNKQSDRATLTRYSKTNHRGPIQLWQFLLELLHDGARS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal hnRNP-Q Antibody (1R0G5)
NBP3-16838-20ul 20 µL

Rabbit Monoclonal hnRNP-Q Antibody (1R0G5)

Sign In for Pricing
View Details
Mouse Monoclonal CD47 Antibody (472603) [Biotin]
FAB4670B 0.1 mL

Mouse Monoclonal CD47 Antibody (472603) [Biotin]

Sign In for Pricing
View Details
OATA00353-25T - Human CD152 Antibody : PE
OATA00353-25T 25 Tests

OATA00353-25T - Human CD152 Antibody : PE

Sign In for Pricing
View Details
Recombinant Rhodopirellula baltica Uridylate kinase (pyrH)
MBS1366966-01 0.02 mg (E-Coli)

Recombinant Rhodopirellula baltica Uridylate kinase (pyrH)

Sign In for Pricing
View Details
Recombinant Rhodopirellula baltica Uridylate kinase (pyrH)
MBS1366966-02 0.02 mg (Yeast)

Recombinant Rhodopirellula baltica Uridylate kinase (pyrH)

Sign In for Pricing
View Details
Recombinant Rhodopirellula baltica Uridylate kinase (pyrH)
MBS1366966-03 0.1 mg (E-Coli)

Recombinant Rhodopirellula baltica Uridylate kinase (pyrH)

Sign In for Pricing
View Details