Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Etv2 Peptide - N-terminal region

Etv2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Etsrp71

UniProt

P41163

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Etv2 Rabbit Polyclonal Antibody (orb329887) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031985

Preservative

Lyophilized powder

AA Sequence

MDLWNWDEASLQEVPPGDKLTGLGAEFGFYFPEVALQEDTPITPMNVEGC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLTP Human Gene Knockout Kit (CRISPR)
KN402925 1 Kit

PLTP Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ABRAXAS2 Antibody
KC-1396-01 50 μL

ABRAXAS2 Antibody

Sign In for Pricing
View Details
ABRAXAS2 Antibody
KC-1396-02 100 µL

ABRAXAS2 Antibody

Sign In for Pricing
View Details
ABRAXAS2 Antibody
KC-1396-03 1 mL

ABRAXAS2 Antibody

Sign In for Pricing
View Details
Di-tert-butyl Azodicarboxylate
TRC-D427950-5G 5 g

Di-tert-butyl Azodicarboxylate

Sign In for Pricing
View Details
Nitrotyrosine Mouse Monoclonal Antibody [Clone ID: 7A5]
AM00099PU-N 100 µg

Nitrotyrosine Mouse Monoclonal Antibody [Clone ID: 7A5]

Sign In for Pricing
View Details