Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Etv2 Peptide - N-terminal region

Etv2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Etsrp71

UniProt

P41163

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Etv2 Rabbit Polyclonal Antibody (orb329887) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031985

Preservative

Lyophilized powder

AA Sequence

MDLWNWDEASLQEVPPGDKLTGLGAEFGFYFPEVALQEDTPITPMNVEGC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Lung
CS806244 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
FAM151B Mouse Monoclonal Antibody [Clone ID: OTI1F5]
CF811466 100 µg

FAM151B Mouse Monoclonal Antibody [Clone ID: OTI1F5]

Sign In for Pricing
View Details
MRPL13 Antibody
8C14057-AAT 50 µg

MRPL13 Antibody

Sign In for Pricing
View Details
Human WNK4 activation kit by CRISPRa
GA112258 1 Kit

Human WNK4 activation kit by CRISPRa

Sign In for Pricing
View Details
CD79b (B-Cell Marker) (IGB/1843), CF740 conjugate, 0.1mg/mL
BNC741843-500 1x 500 µL

CD79b (B-Cell Marker) (IGB/1843), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-Cyclopropyl-4-phenylquinoline-3-carbaldehyde
TRC-C989590-10MG 10 mg

2-Cyclopropyl-4-phenylquinoline-3-carbaldehyde

Sign In for Pricing
View Details