Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ETV7 Peptide - N-terminal region

ETV7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

TEL-2, TEL2, TELB

UniProt

Q9Y603

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ETV7 Rabbit Polyclonal Antibody (orb576412) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057219

Preservative

Lyophilized powder

AA Sequence

SLPCTAEHGFEMNGRALCILTKDDFRHRAPSSGDVLYELLQYIKTQRRAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dock9 (NM_001081039) Mouse Untagged Clone
MC225175 10 µg

Dock9 (NM_001081039) Mouse Untagged Clone

Sign In for Pricing
View Details
Adiponectin (17-41) (Rat) - Cy5 Labeled
FC5-028-60 1 nmol

Adiponectin (17-41) (Rat) - Cy5 Labeled

Sign In for Pricing
View Details
Lentiviral mouse Abhd4 shRNA (UAS) - Lentiviral mouse Abhd4 shRNA (UAS, RFP) plasmid
GTR15167233 1 Vial

Lentiviral mouse Abhd4 shRNA (UAS) - Lentiviral mouse Abhd4 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
7- (4-Bromobenzoyl) -3,3-dibromo-1,3-dihydro-2H-indol-2-one
162257 50 mg

7- (4-Bromobenzoyl) -3,3-dibromo-1,3-dihydro-2H-indol-2-one

Sign In for Pricing
View Details
pMaCTag-P34 Plasmid
PVT17974 2 µg

pMaCTag-P34 Plasmid

Sign In for Pricing
View Details
Mouse CX31 (Connexin 31) ELISA Kit
MBS2501221-01 24 Tests (Limit 1)

Mouse CX31 (Connexin 31) ELISA Kit

Sign In for Pricing
View Details