Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ETV7 Peptide - N-terminal region

ETV7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

TEL-2, TEL2, TELB

UniProt

Q9Y603

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ETV7 Rabbit Polyclonal Antibody (orb576412) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057219

Preservative

Lyophilized powder

AA Sequence

SLPCTAEHGFEMNGRALCILTKDDFRHRAPSSGDVLYELLQYIKTQRRAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Xeligekimab Biosimilar (Monoclonal, IgG4)
A138258 100 µL

Xeligekimab Biosimilar (Monoclonal, IgG4)

Sign In for Pricing
View Details
5-Ethylquinolinic Acid
E932015 100 g

5-Ethylquinolinic Acid

Sign In for Pricing
View Details
GIMAP1 Peptide
MBS3234834-01 0.1 mg

GIMAP1 Peptide

Sign In for Pricing
View Details
GIMAP1 Peptide
MBS3234834-02 5x 0.1 mg

GIMAP1 Peptide

Sign In for Pricing
View Details
Human ITGAV/Integrin alpha-V ELISA Kit
E1346Hu 96 Tests

Human ITGAV/Integrin alpha-V ELISA Kit

Sign In for Pricing
View Details
anti-KI67 (8D5)
LF-MA30460 100 ul

anti-KI67 (8D5)

Sign In for Pricing
View Details