EVI1 Peptide - middle region
EVI1 Peptide - middle region
Product Specifications
Product Name Alternative
AML1-EVI-1, EVI-1, MDS1-EVI1, MGC163392, PRDM3, EVI1, MDS1
UniProt
Q03112
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EVI1 Rabbit Polyclonal Antibody (orb584041) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_005232
Preservative
Lyophilized powder
AA Sequence
KHPSVGDNKPVELQPERSSEERPFEKISDQSESSDLDDVSTPSGSDLETT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
359128-01 48 Tests
TAFI (Thrombin Activatable Fibrinolysis Inhibitor) BioAssayTM ELISA Kit (Rat) discontinued
Sign In for Pricing
View Details 359128-02 96 Tests
TAFI (Thrombin Activatable Fibrinolysis Inhibitor) BioAssayTM ELISA Kit (Rat) discontinued
Sign In for Pricing
View Details 