Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EVI1 Peptide - middle region

EVI1 Peptide - middle region

Product Specifications

Product Name Alternative

AML1-EVI-1, EVI-1, MDS1-EVI1, MGC163392, PRDM3, EVI1, MDS1

UniProt

Q03112

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EVI1 Rabbit Polyclonal Antibody (orb584041) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005232

Preservative

Lyophilized powder

AA Sequence

KHPSVGDNKPVELQPERSSEERPFEKISDQSESSDLDDVSTPSGSDLETT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARL4C ORF Vector (Human) (pORF)
ORF012246 1.0 µg DNA

ARL4C ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Anti-BMP4 Antibody Picoband® (Dylight488 Conjugate)
PB9688-Dylight488 100 µg

Anti-BMP4 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
Fish Cytochrome P450 1A1, CYP1A1 ELISA KIT
EA0012FI 96 Well

Fish Cytochrome P450 1A1, CYP1A1 ELISA KIT

Sign In for Pricing
View Details
A 62176 (hydrochloride)
HY-120750 1 Each

A 62176 (hydrochloride)

Sign In for Pricing
View Details
Rat Adrenomedullin Receptor ELISA Kit
MBS7269453-01 48 Well

Rat Adrenomedullin Receptor ELISA Kit

Sign In for Pricing
View Details
Rat Adrenomedullin Receptor ELISA Kit
MBS7269453-02 96 Well

Rat Adrenomedullin Receptor ELISA Kit

Sign In for Pricing
View Details