Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EVI2A Peptide - C-terminal region

EVI2A Peptide - C-terminal region

Product Specifications

Product Name Alternative

EVDA, EVI2, EVI-2A

UniProt

P22794

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EVI2A Rabbit Polyclonal Antibody (orb324494) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055025

Preservative

Lyophilized powder

AA Sequence

LSTVVLANKVSSLRRSKQVGKRQPRSNGDFLASGLWPAESDTWKRTKQLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carboxypeptidase D Blocking Peptide
CBP3539-01 1 mg

Carboxypeptidase D Blocking Peptide

Sign In for Pricing
View Details
Carboxypeptidase D Blocking Peptide
CBP3539-02 5 mg

Carboxypeptidase D Blocking Peptide

Sign In for Pricing
View Details
Human PPP6R2 Pre-designed siRNA Set B
SI012729B 1 Each

Human PPP6R2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Anti-Zebrafish CROCC2 Antibody Picoband® Fluoro550 Conjugated
AZA0A8M9QG25-Fluoro550 100 µg/Vial

Anti-Zebrafish CROCC2 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
ZNF256, ID (ZNF256, BMZF3, Zinc finger protein 256, Bone marrow zinc finger 3) (PE)
MBS6366018-01 0.2 mL

ZNF256, ID (ZNF256, BMZF3, Zinc finger protein 256, Bone marrow zinc finger 3) (PE)

Sign In for Pricing
View Details
ZNF256, ID (ZNF256, BMZF3, Zinc finger protein 256, Bone marrow zinc finger 3) (PE)
MBS6366018-02 5x 0.2 mL

ZNF256, ID (ZNF256, BMZF3, Zinc finger protein 256, Bone marrow zinc finger 3) (PE)

Sign In for Pricing
View Details