EVI2A Peptide - C-terminal region
EVI2A Peptide - C-terminal region
Product Specifications
Product Name Alternative
EVDA, EVI2, EVI-2A
UniProt
P22794
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EVI2A Rabbit Polyclonal Antibody (orb324494) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_055025
Preservative
Lyophilized powder
AA Sequence
LSTVVLANKVSSLRRSKQVGKRQPRSNGDFLASGLWPAESDTWKRTKQLT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6397716-01 0.1 mL
TXNDC9 (Thioredoxin Domain-containing Protein 9, ATP-binding Protein Associated with Cell Differentiation, APACD, Protein 1-4, PHLP3) (MaxLight 490)
Sign In for Pricing
View Details MBS6397716-02 5x 0.1 mL
TXNDC9 (Thioredoxin Domain-containing Protein 9, ATP-binding Protein Associated with Cell Differentiation, APACD, Protein 1-4, PHLP3) (MaxLight 490)
Sign In for Pricing
View Details MBS1476482-01 0.02 mg (E-Coli)
Recombinant Bacillus phage B103 Lysozyme (15)
Sign In for Pricing
View Details MBS1476482-02 0.02 mg (Yeast)
Recombinant Bacillus phage B103 Lysozyme (15)
Sign In for Pricing
View Details MBS1476482-03 0.1 mg (E-Coli)
Recombinant Bacillus phage B103 Lysozyme (15)
Sign In for Pricing
View Details MBS1476482-04 0.1 mg (Yeast)
Recombinant Bacillus phage B103 Lysozyme (15)
Sign In for Pricing
View Details