Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXOC1 Peptide - N-terminal region

EXOC1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BM-102, FLJ10893, SEC3, SEC3L1, SEC3P

UniProt

Q9NV70

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EXOC1 Rabbit Polyclonal Antibody (orb583705) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060731

Preservative

Lyophilized powder

AA Sequence

NCFLCATVTTERPVQVKVVKVKKSDKGDFYKRQIAWALRDLAVVDAKDAI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSK3 beta (GSK3B) Rabbit Polyclonal Antibody
AP02546PU-N 100 µL

GSK3 beta (GSK3B) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
1-(4-Nitrophenyl) 1,4-Benzenedicarboxylate
TRC-N828230-5MG 5 mg

1-(4-Nitrophenyl) 1,4-Benzenedicarboxylate

Sign In for Pricing
View Details
UAP1 (NM_003115) Human Recombinant Protein
TP303494M 100 µg

UAP1 (NM_003115) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue Total RNA, Thyroid gland
CR560840 5 µg

Tissue Total RNA, Thyroid gland

Sign In for Pricing
View Details
B Raf (BRAF) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B12]
TA500446BM 100 µL

B Raf (BRAF) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B12]

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike RBD (L452R, E484Q) (His Tag)
PKSV030336 100 µg

Recombinant SARS-CoV-2 Spike RBD (L452R, E484Q) (His Tag)

Sign In for Pricing
View Details