Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXOC1 Peptide - N-terminal region

EXOC1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BM-102, FLJ10893, SEC3, SEC3L1, SEC3P

UniProt

Q9NV70

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EXOC1 Rabbit Polyclonal Antibody (orb583705) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060731

Preservative

Lyophilized powder

AA Sequence

NCFLCATVTTERPVQVKVVKVKKSDKGDFYKRQIAWALRDLAVVDAKDAI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CORO1B (NM_020441) Human Over-expression Lysate
LY402787 100 µg

CORO1B (NM_020441) Human Over-expression Lysate

Sign In for Pricing
View Details
4-Tolylhydrazine Monohydrochloride
TRC-T536610-50G 50 g

4-Tolylhydrazine Monohydrochloride

Sign In for Pricing
View Details
ATP6V1B1 (NM_001692) Human Over-expression Lysate
LC400635 20 µg

ATP6V1B1 (NM_001692) Human Over-expression Lysate

Sign In for Pricing
View Details
Urine Total RNA Purification Maxi Kit (Slurry Format)
29600 50 Preparations

Urine Total RNA Purification Maxi Kit (Slurry Format)

Sign In for Pricing
View Details
SSBP2 Antibody
8C10803-AAT 50 µg

SSBP2 Antibody

Sign In for Pricing
View Details
GRAMD2A Human Gene Knockout Kit (CRISPR)
KN420145 1 Kit

GRAMD2A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details