Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXOC1 Peptide - N-terminal region

EXOC1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BM-102, FLJ10893, SEC3, SEC3L1, Sec3p, SEC3P

UniProt

Q9NV70

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EXOC1 Rabbit Polyclonal Antibody (orb583706) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_839955

Preservative

Lyophilized powder

AA Sequence

NVSSQLLEESVPSGENQSVTGGDEEVVDEYQELNAREEQDIEIMMEGCEY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Ileum
CS639294 5x 5 µm

Frozen Tissue Sections, Ileum

Sign In for Pricing
View Details
HSF2 Mouse Monoclonal Antibody [Clone ID: OTI4B2]
CF807485 100 µg

HSF2 Mouse Monoclonal Antibody [Clone ID: OTI4B2]

Sign In for Pricing
View Details
HIF1A Polyclonal Antibody
E-AB-52265-01 20 µL

HIF1A Polyclonal Antibody

Sign In for Pricing
View Details
HIF1A Polyclonal Antibody
E-AB-52265-02 60 µL

HIF1A Polyclonal Antibody

Sign In for Pricing
View Details
HIF1A Polyclonal Antibody
E-AB-52265-03 120 µL

HIF1A Polyclonal Antibody

Sign In for Pricing
View Details
HIF1A Polyclonal Antibody
E-AB-52265-04 200 µL

HIF1A Polyclonal Antibody

Sign In for Pricing
View Details