Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXOC1 Peptide - N-terminal region

EXOC1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BM-102, FLJ10893, SEC3, SEC3L1, Sec3p, SEC3P

UniProt

Q9NV70

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EXOC1 Rabbit Polyclonal Antibody (orb583706) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_839955

Preservative

Lyophilized powder

AA Sequence

NVSSQLLEESVPSGENQSVTGGDEEVVDEYQELNAREEQDIEIMMEGCEY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyanine 5 bissuccinimidyl ester [equivalent to Cy5® bisNHS ester]
157-AAT 1 mg

Cyanine 5 bissuccinimidyl ester [equivalent to Cy5® bisNHS ester]

Sign In for Pricing
View Details
17a-Oxa-D-homo-5beta-androst-1-ene-3,17-dione
TRC-O870735-25MG 25 mg

17a-Oxa-D-homo-5beta-androst-1-ene-3,17-dione

Sign In for Pricing
View Details
N-Propylphosphorothioic Triamide
TRC-P833705-10MG 10 mg

N-Propylphosphorothioic Triamide

Sign In for Pricing
View Details
DUX4 (C-term) Rabbit Polyclonal Antibody
AP51343PU-N 400 µL

DUX4 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MYEF2 Polyclonal Antibody
E-AB-53086-01 20 µL

MYEF2 Polyclonal Antibody

Sign In for Pricing
View Details
MYEF2 Polyclonal Antibody
E-AB-53086-02 60 µL

MYEF2 Polyclonal Antibody

Sign In for Pricing
View Details