Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXOC4 Peptide - N-terminal region

EXOC4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC27170, REC8, SEC8, SEC8L1, Sec8p

UniProt

Q96A65

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EXOC4 Rabbit Polyclonal Antibody (orb583078) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001032203

Preservative

Lyophilized powder

AA Sequence

TAIRTYQSITERITNSRNKIKQVKENLLSCKMLLHCKRDELRKLWIEGIE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTR2 Antibody
orb2675128-01 50 µL

ACTR2 Antibody

Sign In for Pricing
View Details
ACTR2 Antibody
orb2675128-02 100 µL

ACTR2 Antibody

Sign In for Pricing
View Details
ACTR2 Antibody
orb2675128-03 200 µL

ACTR2 Antibody

Sign In for Pricing
View Details
GGA3 Antibody
A69729-50UG 50 µg

GGA3 Antibody

Sign In for Pricing
View Details
CAMKV Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV661658 1.0 µg DNA

CAMKV Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
4-Hydroxyresveratrol
orb2944423-01 50 mg

4-Hydroxyresveratrol

Sign In for Pricing
View Details