Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXOC4 Peptide - N-terminal region

EXOC4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC27170, REC8, SEC8, SEC8L1, Sec8p

UniProt

Q96A65

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EXOC4 Rabbit Polyclonal Antibody (orb583078) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001032203

Preservative

Lyophilized powder

AA Sequence

TAIRTYQSITERITNSRNKIKQVKENLLSCKMLLHCKRDELRKLWIEGIE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Rat ICAM-1 monoclonal antibody, clone S148
CABT-ZB569 50 μl

Rabbit Anti-Rat ICAM-1 monoclonal antibody, clone S148

Sign In for Pricing
View Details
Porcine Retinol Binding Protein 3 ELISA Kit
MBS7271359-01 48 Well

Porcine Retinol Binding Protein 3 ELISA Kit

Sign In for Pricing
View Details
Porcine Retinol Binding Protein 3 ELISA Kit
MBS7271359-02 96 Well

Porcine Retinol Binding Protein 3 ELISA Kit

Sign In for Pricing
View Details
Porcine Retinol Binding Protein 3 ELISA Kit
MBS7271359-03 5x 96 Well

Porcine Retinol Binding Protein 3 ELISA Kit

Sign In for Pricing
View Details
Porcine Retinol Binding Protein 3 ELISA Kit
MBS7271359-04 10x 96 Well

Porcine Retinol Binding Protein 3 ELISA Kit

Sign In for Pricing
View Details
Lys05
MBS385104-01 5 mg

Lys05

Sign In for Pricing
View Details