Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXOC6 Peptide - N-terminal region

EXOC6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp761I2124, EXOC6A, FLJ1125, FLJ11251, MGC33397, SEC15L, SEC15L1, SEC15L3, Sec15p, SEC15

UniProt

B3KXY5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EXOC6 Rabbit Polyclonal Antibody (orb583522) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001013870

Preservative

Lyophilized powder

AA Sequence

MLEEETDQTYENVLAEIQSFELPVEATLRSVYDDQPNAHKKFMEKLDACI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Pisum sativum Glutamine synthetase nodule isozyme (GS1)
MBS1042212-01 0.02 mg (E-Coli)

Recombinant Pisum sativum Glutamine synthetase nodule isozyme (GS1)

Sign In for Pricing
View Details
Recombinant Pisum sativum Glutamine synthetase nodule isozyme (GS1)
MBS1042212-02 0.02 mg (Yeast)

Recombinant Pisum sativum Glutamine synthetase nodule isozyme (GS1)

Sign In for Pricing
View Details
Recombinant Pisum sativum Glutamine synthetase nodule isozyme (GS1)
MBS1042212-03 0.1 mg (E-Coli)

Recombinant Pisum sativum Glutamine synthetase nodule isozyme (GS1)

Sign In for Pricing
View Details
Recombinant Pisum sativum Glutamine synthetase nodule isozyme (GS1)
MBS1042212-04 0.1 mg (Yeast)

Recombinant Pisum sativum Glutamine synthetase nodule isozyme (GS1)

Sign In for Pricing
View Details
Recombinant Pisum sativum Glutamine synthetase nodule isozyme (GS1)
MBS1042212-05 0.02 mg (Baculovirus)

Recombinant Pisum sativum Glutamine synthetase nodule isozyme (GS1)

Sign In for Pricing
View Details
Recombinant Pisum sativum Glutamine synthetase nodule isozyme (GS1)
MBS1042212-06 0.02 mg (Mammalian-Cell)

Recombinant Pisum sativum Glutamine synthetase nodule isozyme (GS1)

Sign In for Pricing
View Details