EXOC6 Peptide - middle region
EXOC6 Peptide - middle region
Product Specifications
Product Name Alternative
DKFZp761I2124, EXOC6A, FLJ1125, FLJ11251, MGC33397, SEC15L, SEC15L1, SEC15L3, Sec15p, SEC15
UniProt
Q8TAG9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EXOC6 Rabbit Polyclonal Antibody (orb583523) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_061926
Preservative
Lyophilized powder
AA Sequence
YRCLHIYSVLGDEETFENYYRKQRKKQARLVLQPQSNMHETVDGYRRYFT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15339465 1 Vial
Lentiviral human TAF5 shRNA (UAS) - Lentiviral human TAF5 shRNA (UAS) (100)
Sign In for Pricing
View Details 
EK10F53-01 48 Test
Bovine TNF Receptor Superfamily Member 25 (TNFRSF25) ELISA Kit-Sandwich
Sign In for Pricing
View Details EK10F53-02 96 Tests
Bovine TNF Receptor Superfamily Member 25 (TNFRSF25) ELISA Kit-Sandwich
Sign In for Pricing
View Details 
RC218914 10 µg
S100 Calcium Binding Protein A13 (S100A13) (NM_001024212) Human Tagged ORF Clone
Sign In for Pricing
View Details 
GTR15182910 1 Vial
Lentiviral mouse Irgm2 shRNA (UAS) - Lentiviral mouse Irgm2 shRNA (UAS) (100)
Sign In for Pricing
View Details