Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXOC6 Peptide - middle region

EXOC6 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp761I2124, EXOC6A, FLJ1125, FLJ11251, MGC33397, SEC15L, SEC15L1, SEC15L3, Sec15p, SEC15

UniProt

Q8TAG9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EXOC6 Rabbit Polyclonal Antibody (orb583523) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061926

Preservative

Lyophilized powder

AA Sequence

YRCLHIYSVLGDEETFENYYRKQRKKQARLVLQPQSNMHETVDGYRRYFT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

D- (+) -Glyceraldehyde
69205379 1 g

D- (+) -Glyceraldehyde

Sign In for Pricing
View Details
Sulbactam Impurity 48
RM-S212316-01 10 mg

Sulbactam Impurity 48

Sign In for Pricing
View Details
Sulbactam Impurity 48
RM-S212316-02 25 mg

Sulbactam Impurity 48

Sign In for Pricing
View Details
Sulbactam Impurity 48
RM-S212316-03 50 mg

Sulbactam Impurity 48

Sign In for Pricing
View Details
Sulbactam Impurity 48
RM-S212316-04 100 mg

Sulbactam Impurity 48

Sign In for Pricing
View Details
Lentiviral human PRKAA2 shRNA (UAS) - Lentiviral human PRKAA2 shRNA (UAS, GFP) plasmid
GTR15080518 1 Vial

Lentiviral human PRKAA2 shRNA (UAS) - Lentiviral human PRKAA2 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details