Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXOC8 Peptide - N-terminal region

EXOC8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

EXO84, Exo84p, SEC84

UniProt

Q8IYI6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EXOC8 Rabbit Polyclonal Antibody (orb582033) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_787072

Preservative

Lyophilized powder

AA Sequence

MAMAMSDSGASRLRRQLESGGFEARLYVKQLSQQSDGDRDLQEHRQRIQA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human MDM2 protein
MBS1561103-01 0.05 mg

Recombinant Human MDM2 protein

Sign In for Pricing
View Details
Recombinant Human MDM2 protein
MBS1561103-02 0.1 mg

Recombinant Human MDM2 protein

Sign In for Pricing
View Details
Recombinant Human MDM2 protein
MBS1561103-03 5x 0.1 mg

Recombinant Human MDM2 protein

Sign In for Pricing
View Details
Rabbit Monoclonal LOX-1/OLR1 Antibody (001) [FITC]
NBP2-89574F 0.1 mL

Rabbit Monoclonal LOX-1/OLR1 Antibody (001) [FITC]

Sign In for Pricing
View Details
Monkey Synaptic Vesicle Glycoprotein 2A ELISA Kit
MBS7280705-01 48 Well

Monkey Synaptic Vesicle Glycoprotein 2A ELISA Kit

Sign In for Pricing
View Details
Monkey Synaptic Vesicle Glycoprotein 2A ELISA Kit
MBS7280705-02 96 Well

Monkey Synaptic Vesicle Glycoprotein 2A ELISA Kit

Sign In for Pricing
View Details