Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXOC8 Peptide - N-terminal region

EXOC8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

EXO84, Exo84p, SEC84

UniProt

Q8IYI6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EXOC8 Rabbit Polyclonal Antibody (orb582033) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_787072

Preservative

Lyophilized powder

AA Sequence

MAMAMSDSGASRLRRQLESGGFEARLYVKQLSQQSDGDRDLQEHRQRIQA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Hepatocyte Specific Antigen Antibody (HSA98) [FITC]
NBP2-34645F 0.1 mL

Mouse Monoclonal Hepatocyte Specific Antigen Antibody (HSA98) [FITC]

Sign In for Pricing
View Details
mmu-miR-7118-3p Primers
MPM02021 150 µL / 10 µM

mmu-miR-7118-3p Primers

Sign In for Pricing
View Details
Bovine Annexin 2 receptor (C5orf39) ELISA kit
GTR10474458 96 Well

Bovine Annexin 2 receptor (C5orf39) ELISA kit

Sign In for Pricing
View Details
Mouse Monoclonal ST6 Gal Sialyltransferase 1/ST6GAL1/CD75 Antibody (ZB55)
NBP3-07770-100ug 100 µg

Mouse Monoclonal ST6 Gal Sialyltransferase 1/ST6GAL1/CD75 Antibody (ZB55)

Sign In for Pricing
View Details
OsCOI1 Rabbit pAb
orb2706207-01 50 µL

OsCOI1 Rabbit pAb

Sign In for Pricing
View Details
OsCOI1 Rabbit pAb
orb2706207-02 100 µL

OsCOI1 Rabbit pAb

Sign In for Pricing
View Details