Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXOD1 Peptide - N-terminal region

EXOD1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

KIAA1504, MGC16943, EXOD1

UniProt

A8K979

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EXOD1 Rabbit Polyclonal Antibody (orb581725) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_542394

Preservative

Lyophilized powder

AA Sequence

GQIDSEFQAYVQPQEHPILSEFCMELTGIKQAQVDEGVPLKICLSQFCKW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRC41 Rabbit Polyclonal Antibody
AP21191PU-N 100 µg

LRRC41 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Z-KKAG-AMC
13554-AAT 1 mg

Z-KKAG-AMC

Sign In for Pricing
View Details
GAS8-AS1 (NM_001214) Human Over-expression Lysate
LC420070 20 µg

GAS8-AS1 (NM_001214) Human Over-expression Lysate

Sign In for Pricing
View Details
CAPS Antibody
KC-2188-01 50 μL

CAPS Antibody

Sign In for Pricing
View Details
CAPS Antibody
KC-2188-02 100 µL

CAPS Antibody

Sign In for Pricing
View Details
CAPS Antibody
KC-2188-03 1 mL

CAPS Antibody

Sign In for Pricing
View Details