Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXOD1 Peptide - N-terminal region

EXOD1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

KIAA1504, MGC16943, EXOD1

UniProt

A8K979

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EXOD1 Rabbit Polyclonal Antibody (orb581725) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_542394

Preservative

Lyophilized powder

AA Sequence

GQIDSEFQAYVQPQEHPILSEFCMELTGIKQAQVDEGVPLKICLSQFCKW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLK9 Antibody (Biotin)
KB-40034-01 50 μL

KLK9 Antibody (Biotin)

Sign In for Pricing
View Details
KLK9 Antibody (Biotin)
KB-40034-02 100 µL

KLK9 Antibody (Biotin)

Sign In for Pricing
View Details
KLK9 Antibody (Biotin)
KB-40034-03 1 mL

KLK9 Antibody (Biotin)

Sign In for Pricing
View Details
Phenylbutyrate
P007-1GM 1 Each

Phenylbutyrate

Sign In for Pricing
View Details
Protein A/G Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - White PS
MTW08F4-PAG 10x 96 Well Plates

Protein A/G Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - White PS

Sign In for Pricing
View Details
TIE1 (NM_005424) Human Recombinant Protein
TP720418M 50 µg

TIE1 (NM_005424) Human Recombinant Protein

Sign In for Pricing
View Details